Lineage for d2vhpu1 (2vhp U:3-53)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2652110Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2652111Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) (S)
  5. 2652112Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
    Pfam PF01165
  6. 2652113Protein Ribosomal protein S21, RpsU [161310] (1 species)
  7. 2652114Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
    Uniprot P68679 4-54
  8. 2652132Domain d2vhpu1: 2vhp U:3-53 [153165]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhpu1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2vhpu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

SCOPe Domain Coordinates for d2vhpu1:

Click to download the PDB-style file with coordinates for d2vhpu1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpu1: