![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
![]() | Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
![]() | Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
![]() | Protein Ribosomal protein S7 [47975] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
![]() | Domain d2vhpg1: 2vhp G:2-151 [153151] Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vhp (more details), 3.74 Å
SCOPe Domain Sequences for d2vhpg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhpg1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d2vhpg1: