Lineage for d2vhpk1 (2vhp K:12-128)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495356Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2495357Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2495447Protein Ribosomal protein S11 [53141] (2 species)
  7. 2495448Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
    Uniprot P0A7R9 12-128
  8. 2495466Domain d2vhpk1: 2vhp K:12-128 [153155]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhpk1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2vhpk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

SCOPe Domain Coordinates for d2vhpk1:

Click to download the PDB-style file with coordinates for d2vhpk1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpk1: