SCOPe 2.02: Domain d2vhpe2: 2vhp E:9-77

Lineage for d2vhpe2 (2vhp E:9-77)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
   Uniprot P0A7W1 9-77

8. Domain d2vhpe2: 2vhp E:9-77 [153149]
   Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
   automatically matched to 2AVY E:9-77
   protein/RNA complex; complexed with mg

Details for d2vhpe2

PDB Entry: 2vhp, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2vhpe2:

Sequence; same for both SEQRES and ATOM records:

>d2vhpe2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

Timeline for d2vhpe2:

• d2vhpe2 first appeared in SCOP 1.75
  
• d2vhpe2 appears in SCOPe 2.01
  
• d2vhpe2 appears in SCOPe 2.03
  
• d2vhpe2 appears in the current release, SCOPe 2.08