Lineage for d2vhpq1 (2vhp Q:3-82)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125285Protein Ribosomal protein S17 [50304] (3 species)
  7. 1125288Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 1125312Domain d2vhpq1: 2vhp Q:3-82 [153161]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
    automatically matched to 2AVY Q:3-82
    protein/RNA complex; complexed with mg

Details for d2vhpq1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2vhpq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav

SCOPe Domain Coordinates for d2vhpq1:

Click to download the PDB-style file with coordinates for d2vhpq1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpq1: