SCOPe 2.01: Domain d2vhoj1: 2vho J:5-102

Lineage for d2vhoj1 (2vho J:5-102)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family)

5. Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)

6. Protein Ribosomal protein S10 [55001] (2 species)

7. Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
   Uniprot P0A7R5 5-102

8. Domain d2vhoj1: 2vho J:5-102 [153132]
   Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
   automatically matched to 2AVY J:5-102
   protein/RNA complex; complexed with mg

Details for d2vhoj1

PDB Entry: 2vho, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)

PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2vhoj1:

Sequence; same for both SEQRES and ATOM records:

>d2vhoj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

Timeline for d2vhoj1:

• d2vhoj1 first appeared in SCOP 1.75
  
• d2vhoj1 appears in SCOPe 2.02
  
• d2vhoj1 appears in the current release, SCOPe 2.08