![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160319] (24 PDB entries) Uniprot P0A7R5 5-102 |
![]() | Domain d2vhoj1: 2vho J:5-102 [153132] Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1 automatically matched to 2AVY J:5-102 protein/RNA complex; complexed with mg |
PDB Entry: 2vho (more details), 3.74 Å
SCOPe Domain Sequences for d2vhoj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhoj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]} ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq yeirthlrlvdiveptektvdalmrldlaagvdvqisl
Timeline for d2vhoj1: