Lineage for d2vhoc2 (2vho C:106-206)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1025874Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1025875Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 1025876Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1025877Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1025878Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
    Uniprot P0A7V3 106-206
  8. 1025899Domain d2vhoc2: 2vho C:106-206 [153124]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
    automatically matched to 2AVY C:106-206
    protein/RNA complex; complexed with mg

Details for d2vhoc2

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2vhoc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhoc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

SCOPe Domain Coordinates for d2vhoc2:

Click to download the PDB-style file with coordinates for d2vhoc2.
(The format of our PDB-style files is described here.)

Timeline for d2vhoc2: