Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class sigma GST [81362] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [89705] (11 PDB entries) Uniprot O60760 synonym: hematopoietic prostaglandin D synthase |
Domain d2vd1d2: 2vd1 D:2-75 [152969] Other proteins in same PDB: d2vd1a1, d2vd1b1, d2vd1c1, d2vd1d1 automatically matched to d1iyha2 complexed with d28, gsh, mg |
PDB Entry: 2vd1 (more details), 2.25 Å
SCOPe Domain Sequences for d2vd1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vd1d2 c.47.1.5 (D:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl hqslaiaryltknt
Timeline for d2vd1d2: