Lineage for d2v9je1 (2v9j E:182-326)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901515Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1901516Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1901517Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1901518Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 1901519Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (7 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 1901526Domain d2v9je1: 2v9j E:182-326 [152807]
    Other proteins in same PDB: d2v9ja_, d2v9jb_
    automated match to d2v8qe1
    complexed with amp, atp, mg

Details for d2v9je1

PDB Entry: 2v9j (more details), 2.53 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2v9je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9je1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv
vdehdvvkgivslsdilqalvltgg

SCOPe Domain Coordinates for d2v9je1:

Click to download the PDB-style file with coordinates for d2v9je1.
(The format of our PDB-style files is described here.)

Timeline for d2v9je1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v9je2