Lineage for d2v9je1 (2v9j E:182-326)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858507Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 858508Superfamily d.37.1: CBS-domain pair [54631] (1 family) (S)
  5. 858509Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 858510Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 858511Species Rat (Rattus norvegicus) [TaxId:10116] [160177] (3 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 858516Domain d2v9je1: 2v9j E:182-326 [152807]
    Other proteins in same PDB: d2v9ja1, d2v9jb1
    automatically matched to 2V8Q E:182-326
    complexed with amp, atp, mg

Details for d2v9je1

PDB Entry: 2v9j (more details), 2.53 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp
PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOP Domain Sequences for d2v9je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9je1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv
vdehdvvkgivslsdilqalvltgg

SCOP Domain Coordinates for d2v9je1:

Click to download the PDB-style file with coordinates for d2v9je1.
(The format of our PDB-style files is described here.)

Timeline for d2v9je1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v9je2