Lineage for d2v7qg_ (2v7q G:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1170081Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1170197Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 1170198Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
  6. 1170199Protein ATP synthase (F1-ATPase), gamma subunit [52945] (3 species)
  7. 1170200Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
    Uniprot P05631
  8. 1170203Domain d2v7qg_: 2v7q G: [152732]
    Other proteins in same PDB: d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj1
    automated match to d1bmfg_
    complexed with adp, atp, mg, po4

Details for d2v7qg_

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (G:) ATP synthase gamma chain

SCOPe Domain Sequences for d2v7qg_:

Sequence, based on SEQRES records: (download)

>d2v7qg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records): (download)

>d2v7qg_ c.49.2.1 (G:) ATP synthase (F1-ATPase), gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktk
hliigvssdrglcgaihssvakqmkseaanlkevkiigvgdkirsilhrthsdqflvtfk
evgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifsldtissaes
msiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknasemidkltlt
fnrtrqavitkelieiisgaaal

SCOPe Domain Coordinates for d2v7qg_:

Click to download the PDB-style file with coordinates for d2v7qg_.
(The format of our PDB-style files is described here.)

Timeline for d2v7qg_: