Class a: All alpha proteins [46456] (284 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) |
Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins) |
Protein automated matches [190373] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187216] (4 PDB entries) |
Domain d2v7qi_: 2v7q I: [152735] Other proteins in same PDB: d2v7qg_, d2v7qh1, d2v7qh2, d2v7qj1 automated match to d1e79i_ complexed with adp, atp, mg, po4 |
PDB Entry: 2v7q (more details), 2.1 Å
SCOPe Domain Sequences for d2v7qi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7qi_ a.137.8.1 (I:) automated matches {Cow (Bos taurus) [TaxId: 9913]} vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv
Timeline for d2v7qi_:
View in 3D Domains from other chains: (mouse over for more information) d2v7qg_, d2v7qh1, d2v7qh2, d2v7qj1 |