Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries) |
Domain d2v63j1: 2v63 J:2-140 [152610] Other proteins in same PDB: d2v63a1, d2v63a2, d2v63b1, d2v63b2, d2v63c1, d2v63c2, d2v63d1, d2v63d2, d2v63e1, d2v63e2, d2v63f1, d2v63f2, d2v63g1, d2v63g2, d2v63h1, d2v63h2 automatically matched to d1ir21_ complexed with cap, edo, mg, mme; mutant |
PDB Entry: 2v63 (more details), 1.8 Å
SCOP Domain Sequences for d2v63j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v63j1 d.73.1.1 (J:2-140) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf lvqrpktardfqpankrsv
Timeline for d2v63j1: