Lineage for d2v63b2 (2v63 B:9-149)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862555Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries)
  8. 862601Domain d2v63b2: 2v63 B:9-149 [152596]
    Other proteins in same PDB: d2v63a1, d2v63b1, d2v63c1, d2v63d1, d2v63e1, d2v63f1, d2v63g1, d2v63h1, d2v63i1, d2v63j1, d2v63k1, d2v63l1, d2v63m1, d2v63n1, d2v63o1, d2v63p1
    automatically matched to d1gk8a2
    complexed with cap, edo, mg, mme; mutant

Details for d2v63b2

PDB Entry: 2v63 (more details), 1.8 Å

PDB Description: Crystal structure of Rubisco from Chlamydomonas reinhardtii with a large-subunit V331A mutation
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d2v63b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v63b2 d.58.9.1 (B:9-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
alralrledlrippayvktfv

SCOP Domain Coordinates for d2v63b2:

Click to download the PDB-style file with coordinates for d2v63b2.
(The format of our PDB-style files is described here.)

Timeline for d2v63b2: