SCOP 1.75: Domain d2v63b2: 2v63 B:9-149

Lineage for d2v63b2 (2v63 B:9-149)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries)

8. Domain d2v63b2: 2v63 B:9-149 [152596]
   Other proteins in same PDB: d2v63a1, d2v63b1, d2v63c1, d2v63d1, d2v63e1, d2v63f1, d2v63g1, d2v63h1, d2v63i1, d2v63j1, d2v63k1, d2v63l1, d2v63m1, d2v63n1, d2v63o1, d2v63p1
   automatically matched to d1gk8a2
   complexed with cap, edo, mg, mme; mutant

Details for d2v63b2

PDB Entry: 2v63, 1.8 Å

PDB Description: Crystal structure of Rubisco from Chlamydomonas reinhardtii with a large-subunit V331A mutation

PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d2v63b2:

Sequence; same for both SEQRES and ATOM records:

>d2v63b2 d.58.9.1 (B:9-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
alralrledlrippayvktfv

Timeline for d2v63b2:

• d2v63b2 is new in SCOP 1.75
  
• d2v63b2 appears in SCOPe 2.01
  
• d2v63b2 appears in the current release, SCOPe 2.08