![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries) |
![]() | Domain d2v63e2: 2v63 E:11-149 [152602] Other proteins in same PDB: d2v63a1, d2v63b1, d2v63c1, d2v63d1, d2v63e1, d2v63f1, d2v63g1, d2v63h1, d2v63i1, d2v63j1, d2v63k1, d2v63l1, d2v63m1, d2v63n1, d2v63o1, d2v63p1 automatically matched to d1gk8a2 complexed with cap, edo, mg, mme; mutant |
PDB Entry: 2v63 (more details), 1.8 Å
SCOP Domain Sequences for d2v63e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v63e2 d.58.9.1 (E:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal ralrledlrippayvktfv
Timeline for d2v63e2: