Lineage for d2v63l1 (2v63 L:2-140)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865003Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865004Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 865005Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 865006Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 865012Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries)
  8. 865060Domain d2v63l1: 2v63 L:2-140 [152612]
    Other proteins in same PDB: d2v63a1, d2v63a2, d2v63b1, d2v63b2, d2v63c1, d2v63c2, d2v63d1, d2v63d2, d2v63e1, d2v63e2, d2v63f1, d2v63f2, d2v63g1, d2v63g2, d2v63h1, d2v63h2
    automatically matched to d1ir21_
    complexed with cap, edo, mg, mme; mutant

Details for d2v63l1

PDB Entry: 2v63 (more details), 1.8 Å

PDB Description: Crystal structure of Rubisco from Chlamydomonas reinhardtii with a large-subunit V331A mutation
PDB Compounds: (L:) ribulose bisphosphate carboxylase small chain 1

SCOP Domain Sequences for d2v63l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v63l1 d.73.1.1 (L:2-140) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrpktardfqpankrsv

SCOP Domain Coordinates for d2v63l1:

Click to download the PDB-style file with coordinates for d2v63l1.
(The format of our PDB-style files is described here.)

Timeline for d2v63l1: