Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.203: DsrC, the gamma subunit of dissimilatory sulfite reductase [69720] (1 superfamily) beta(3)-alpha(5); meander beta-sheet packed against array of helices |
Superfamily d.203.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69721] (2 families) |
Family d.203.1.1: DsrC, the gamma subunit of dissimilatory sulfite reductase [69722] (2 proteins) automatically mapped to Pfam PF04358 |
Protein DsrC, the gamma subunit of dissimilatory sulfite reductase [69723] (4 species) |
Species Desulfovibrio vulgaris [TaxId:881] [160276] (1 PDB entry) Uniprot P45573 3-105 |
Domain d2v4jc1: 2v4j C:3-105 [152562] Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf_ complexed with sf4, so3, srm |
PDB Entry: 2v4j (more details), 2.1 Å
SCOPe Domain Sequences for d2v4jc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4jc1 d.203.1.1 (C:3-105) DsrC, the gamma subunit of dissimilatory sulfite reductase {Desulfovibrio vulgaris [TaxId: 881]} evtykgksfevdedgfllrfddwcpewveyvkesegisdispdhqkiidflqdyykkngi apmvrilskntgfklkevyelfpsgpgkgackmaglpkptgcv
Timeline for d2v4jc1: