![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein DsrB insert domain [160277] (2 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [160278] (1 PDB entry) Uniprot P45575 209-277 |
![]() | Domain d2v4jb1: 2v4j B:209-277 [152559] Other proteins in same PDB: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd2, d2v4jd3, d2v4je2, d2v4je3, d2v4jf_ complexed with sf4, so3, srm |
PDB Entry: 2v4j (more details), 2.1 Å
SCOPe Domain Sequences for d2v4jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4jb1 d.58.1.5 (B:209-277) DsrB insert domain {Desulfovibrio vulgaris [TaxId: 881]} kppmidhewtdqlceiplavascptaavrptkleigdkkvntiaiknercmycgncytmc palpisdge
Timeline for d2v4jb1: