![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
![]() | Protein Glucosylceramidase [89389] (1 species) glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89390] (11 PDB entries) |
![]() | Domain d2v3fb1: 2v3f B:1-77,B:432-497 [152455] Other proteins in same PDB: d2v3fa2, d2v3fb2 automatically matched to d1ogsa1 complexed with btb, so4 |
PDB Entry: 2v3f (more details), 1.95 Å
SCOPe Domain Sequences for d2v3fb1:
Sequence, based on SEQRES records: (download)
>d2v3fb1 b.71.1.2 (B:1-77,B:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]} arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik dpavgfletispgysihtylwhrq
>d2v3fb1 b.71.1.2 (B:1-77,B:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]} arpcipksfgyssvvcvcnatycdsfalgtfsryestrsgrrmelsmgpiqanhtgtgll ltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltikdpavgf letispgysihtylwhrq
Timeline for d2v3fb1: