Lineage for d2v3fa1 (2v3f A:1-77,A:432-497)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960875Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 960876Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 961258Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 961315Protein Glucosylceramidase [89389] (1 species)
    glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core
  7. 961316Species Human (Homo sapiens) [TaxId:9606] [89390] (11 PDB entries)
  8. 961323Domain d2v3fa1: 2v3f A:1-77,A:432-497 [152453]
    Other proteins in same PDB: d2v3fa2, d2v3fb2
    automatically matched to d1ogsa1
    complexed with btb, so4

Details for d2v3fa1

PDB Entry: 2v3f (more details), 1.95 Å

PDB Description: acid-beta-glucosidase produced in carrot
PDB Compounds: (A:) glucosylceramidase

SCOPe Domain Sequences for d2v3fa1:

Sequence, based on SEQRES records: (download)

>d2v3fa1 b.71.1.2 (A:1-77,A:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

Sequence, based on observed residues (ATOM records): (download)

>d2v3fa1 b.71.1.2 (A:1-77,A:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdppalgtfsryestrsgrrmelsmgpiqanhtgt
gllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltikdpa
vgfletispgysihtylwhrq

SCOPe Domain Coordinates for d2v3fa1:

Click to download the PDB-style file with coordinates for d2v3fa1.
(The format of our PDB-style files is described here.)

Timeline for d2v3fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v3fa2