Lineage for d2uzab4 (2uza B:416-668)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864327Fold c.64: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53322] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 231456; strand 3 is antiparallel to the rest
  4. 1864328Superfamily c.64.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53323] (1 family) (S)
  5. 1864329Family c.64.1.1: Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53324] (1 protein)
  6. 1864330Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain III [53325] (1 species)
    also includes linker domain IV
  7. 1864331Species Desulfovibrio africanus [TaxId:873] [53326] (10 PDB entries)
  8. 1864347Domain d2uzab4: 2uza B:416-668 [152333]
    Other proteins in same PDB: d2uzaa1, d2uzaa2, d2uzaa3, d2uzaa5, d2uzab1, d2uzab2, d2uzab3, d2uzab5
    automated match to d1keka4
    complexed with ca, co2, htl, mg, sf4

Details for d2uzab4

PDB Entry: 2uza (more details), 2.42 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (B:) pyruvate ferredoxin oxidoreductase

SCOPe Domain Sequences for d2uzab4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzab4 c.64.1.1 (B:416-668) Pyruvate-ferredoxin oxidoreductase, PFOR, domain III {Desulfovibrio africanus [TaxId: 873]}
gtiqcqfwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpi
qstylvnradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtia
nkklkfynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkg
ekivkmntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklp
vsafeadgrfplg

SCOPe Domain Coordinates for d2uzab4:

Click to download the PDB-style file with coordinates for d2uzab4.
(The format of our PDB-style files is described here.)

Timeline for d2uzab4: