Lineage for d2uzaa3 (2uza A:259-415)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855607Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1855608Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1855751Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 1855752Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 1855753Species Desulfovibrio africanus [TaxId:873] [52933] (10 PDB entries)
  8. 1855768Domain d2uzaa3: 2uza A:259-415 [152327]
    Other proteins in same PDB: d2uzaa1, d2uzaa2, d2uzaa4, d2uzaa5, d2uzab1, d2uzab2, d2uzab4, d2uzab5
    automated match to d1keka3
    complexed with ca, co2, htl, mg, sf4

Details for d2uzaa3

PDB Entry: 2uza (more details), 2.42 Å

PDB Description: crystal structure of the free radical intermediate of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
PDB Compounds: (A:) pyruvate ferredoxin oxidoreductase

SCOPe Domain Sequences for d2uzaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzaa3 c.48.1.3 (A:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOPe Domain Coordinates for d2uzaa3:

Click to download the PDB-style file with coordinates for d2uzaa3.
(The format of our PDB-style files is described here.)

Timeline for d2uzaa3: