Lineage for d2uz9a1 (2uz9 A:8-75,A:389-451)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819264Family b.92.1.4: SAH/MTA deaminase-like [82224] (3 proteins)
  6. 2819265Protein Guanine deaminase [159336] (3 species)
  7. 2819271Species Human (Homo sapiens) [TaxId:9606] [159338] (2 PDB entries)
    Uniprot Q9Y2T3 8-75,389-451
  8. 2819273Domain d2uz9a1: 2uz9 A:8-75,A:389-451 [152323]
    Other proteins in same PDB: d2uz9a2
    complexed with xan, zn

Details for d2uz9a1

PDB Entry: 2uz9 (more details), 2.3 Å

PDB Description: human guanine deaminase (guad) in complex with zinc and its product xanthine.
PDB Compounds: (A:) guanine deaminase

SCOPe Domain Sequences for d2uz9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uz9a1 b.92.1.4 (A:8-75,A:389-451) Guanine deaminase {Human (Homo sapiens) [TaxId: 9606]}
plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire
lshheffmXfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrniee
vyvggkqvvpfs

SCOPe Domain Coordinates for d2uz9a1:

Click to download the PDB-style file with coordinates for d2uz9a1.
(The format of our PDB-style files is described here.)

Timeline for d2uz9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uz9a2