SCOPe 2.06: Domain d2rfkb_: 2rfk B:

Lineage for d2rfkb_ (2rfk B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)
   automatically mapped to Pfam PF04135

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein Ribosome biogenesis protein Nop10 [144214] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries)
   Uniprot Q8U1R4 4-55

8. Domain d2rfkb_: 2rfk B: [151998]
   Other proteins in same PDB: d2rfka1, d2rfka2, d2rfkc_
   automated match to d2ey4e1
   protein/RNA complex; complexed with zn

Details for d2rfkb_

PDB Entry: 2rfk, 2.87 Å

PDB Description: substrate rna positioning in the archaeal h/aca ribonucleoprotein complex

PDB Compounds: (B:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2rfkb_:

Sequence; same for both SEQRES and ATOM records:

>d2rfkb_ g.41.16.1 (B:) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]}
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

Timeline for d2rfkb_:

• d2rfkb_ first appeared in SCOP 1.75, called d2rfkb1
  
• d2rfkb_ appears in SCOPe 2.05
  
• d2rfkb_ appears in SCOPe 2.07
  
• d2rfkb_ appears in the current release, SCOPe 2.08