Lineage for d2ey4e1 (2ey4 E:4-55)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263926Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) (S)
    automatically mapped to Pfam PF04135
  5. 2263927Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
    Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)
  6. 2263934Protein Ribosome biogenesis protein Nop10 [144214] (2 species)
  7. 2263938Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries)
    Uniprot Q8U1R4 4-55
  8. 2263940Domain d2ey4e1: 2ey4 E:4-55 [132584]
    Other proteins in same PDB: d2ey4a1, d2ey4a2, d2ey4b1, d2ey4b2, d2ey4c1, d2ey4d_, d2ey4f_
    complexed with zn

Details for d2ey4e1

PDB Entry: 2ey4 (more details), 2.11 Å

PDB Description: crystal structure of a cbf5-nop10-gar1 complex
PDB Compounds: (E:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2ey4e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ey4e1 g.41.16.1 (E:4-55) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]}
rirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

SCOPe Domain Coordinates for d2ey4e1:

Click to download the PDB-style file with coordinates for d2ey4e1.
(The format of our PDB-style files is described here.)

Timeline for d2ey4e1: