SCOPe 2.08: Domain d2rb6b2: 2rb6 B:25-76

Lineage for d2rb6b2 (2rb6 B:25-76)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
   Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals

6. Protein Uncharacterized protein SO0963 [159053] (1 species)

7. Species Shewanella oneidensis [TaxId:70863] [159054] (1 PDB entry)
   Uniprot Q8EI81 25-76

8. Domain d2rb6b2: 2rb6 B:25-76 [151845]
   Other proteins in same PDB: d2rb6a2, d2rb6b3
   automated match to d2rb6a1

Details for d2rb6b2

PDB Entry: 2rb6, 2.5 Å

PDB Description: x-ray structure of the protein q8ei81. northeast structural genomics consortium target sor78a

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2rb6b2:

Sequence; same for both SEQRES and ATOM records:

>d2rb6b2 b.38.1.6 (B:25-76) Uncharacterized protein SO0963 {Shewanella oneidensis [TaxId: 70863]}
ssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiier

Timeline for d2rb6b2:

• d2rb6b2 first appeared in SCOP 1.75, called d2rb6b1
  
• d2rb6b2 appears in SCOPe 2.07