Lineage for d2ra2e_ (2ra2 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787385Family b.38.1.6: YgdI/YgdR-like [159052] (7 proteins)
    Pfam PF06004; DUF903, putative lipoprotein; both homohexameric and homoheptameric ring assemblies are observed in the crystals
  6. 2787410Protein Uncharacterized protein YgdI [159055] (1 species)
  7. 2787411Species Salmonella typhimurium [TaxId:90371] [159056] (1 PDB entry)
    Uniprot Q7CPV8 23-75
  8. 2787416Domain d2ra2e_: 2ra2 E: [151815]
    Other proteins in same PDB: d2ra2a2, d2ra2b3, d2ra2b4, d2ra2c3
    automated match to d2ra2a1

Details for d2ra2e_

PDB Entry: 2ra2 (more details), 1.9 Å

PDB Description: X-Ray structure of the Q7CPV8 protein from Salmonella typhimurium at the resolution 1.9 A. Northeast Structural Genomics Consortium target StR88A
PDB Compounds: (E:) Putative lipoprotein

SCOPe Domain Sequences for d2ra2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ra2e_ b.38.1.6 (E:) Uncharacterized protein YgdI {Salmonella typhimurium [TaxId: 90371]}
pnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalen

SCOPe Domain Coordinates for d2ra2e_:

Click to download the PDB-style file with coordinates for d2ra2e_.
(The format of our PDB-style files is described here.)

Timeline for d2ra2e_: