Lineage for d2qpec_ (2qpe C:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins)
  6. Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries)
  8. Domain d2qpec_: 2qpe C: [151204]
    Other proteins in same PDB: d2qpea_, d2qpeb1, d2qpeb2
    automated match to d1xmec1
    complexed with cu1, cua, has, hem

Details for d2qpec_

PDB Entry: 2qpe (more details), 2.9 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d2qpec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpec_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d2qpec_ are not available.

Timeline for d2qpec_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qpea_, d2qpeb1, d2qpeb2