Lineage for d2qpea_ (2qpe A:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries)
  8. Domain d2qpea_: 2qpe A: [161538]
    Other proteins in same PDB: d2qpeb1, d2qpeb2, d2qpec_
    automated match to d1ehka_
    complexed with cu1, cua, has, hem

Details for d2qpea_

PDB Entry: 2qpe (more details), 2.9 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d2qpea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpea_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
seisrvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsy
yqgltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvaalpll
aneatvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtym
avvfwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpivyfwllpaya
iiytilpkqaggrlvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfv
avpslmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggiv
nasftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavv
wlwflgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfi
yglfsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygpt
lvqlfghlnpvpgwrlw

SCOPe Domain Coordinates for d2qpea_ are not available.

Timeline for d2qpea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2qpeb1, d2qpeb2, d2qpec_