SCOPe 2.06: Domain d2qpeb2: 2qpe B:3-36

Lineage for d2qpeb2 (2qpe B:3-36)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.0: automated matches [227239] (1 protein)
   not a true family

6. Protein automated matches [226999] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries)

8. Domain d2qpeb2: 2qpe B:3-36 [151203]
   Other proteins in same PDB: d2qpea_, d2qpeb1, d2qpec_
   automated match to d3qjsb1
   complexed with cu1, cua, has, hem

Details for d2qpeb2

PDB Entry: 2qpe, 2.9 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2qpeb2:

Sequence; same for both SEQRES and ATOM records:

>d2qpeb2 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dqhkahkailayekgwlafslamlfvfialiayt

Timeline for d2qpeb2:

• d2qpeb2 first appeared in SCOP 1.75
  
• d2qpeb2 appears in SCOPe 2.05
  
• d2qpeb2 appears in SCOPe 2.07
  
• d2qpeb2 appears in the current release, SCOPe 2.08