![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) ![]() |
![]() | Family f.17.2.0: automated matches [227239] (1 protein) not a true family |
![]() | Protein automated matches [226999] (2 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [225642] (8 PDB entries) |
![]() | Domain d2qpeb2: 2qpe B:3-36 [151203] Other proteins in same PDB: d2qpea_, d2qpeb1, d2qpec_ automated match to d3qjsb1 complexed with cu1, cua, has, hem |
PDB Entry: 2qpe (more details), 2.9 Å
SCOPe Domain Sequences for d2qpeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpeb2 f.17.2.0 (B:3-36) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dqhkahkailayekgwlafslamlfvfialiayt
Timeline for d2qpeb2: