![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) ![]() |
![]() | Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins) |
![]() | Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [81459] (5 PDB entries) the "missing" first helix is complemented by the ba3 subunit IIa |
![]() | Domain d2qpeb2: 2qpe B:3-36 [151203] Other proteins in same PDB: d2qpeb1, d2qpec1 automatically matched to d1ehkb2 complexed with cu1, cua, has, hem; mutant |
PDB Entry: 2qpe (more details), 2.9 Å
SCOP Domain Sequences for d2qpeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpeb2 f.17.2.1 (B:3-36) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]} dqhkahkailayekgwlafslamlfvfialiayt
Timeline for d2qpeb2: