SCOPe 2.08: Domain d2qp0d1: 2qp0 D:1-205

Lineage for d2qp0d1 (2qp0 D:1-205)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (3 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
   Uniprot P0A7V8 1-205

8. Domain d2qp0d1: 2qp0 D:1-205 [151146]
   Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1
   protein/RNA complex; complexed with mg, nmy, scm
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qp0d1

PDB Entry: 2qp0, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2qp0d1:

Sequence; same for both SEQRES and ATOM records:

>d2qp0d1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

Timeline for d2qp0d1:

• d2qp0d1 first appeared in SCOP 1.75
  
• d2qp0d1 appears in SCOPe 2.07