![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
![]() | Protein 70S ribosome functional complex [58121] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
![]() | Domain d2qp0h1: 2qp0 H:2-128 [151151] Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1 protein/RNA complex; complexed with mg, nmy, scm protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qp0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qp0h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp0h1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg geiicyv
Timeline for d2qp0h1: