SCOPe 2.06: Domain d2qoyc2: 2qoy C:106-206

Lineage for d2qoyc2 (2qoy C:106-206)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
   Uniprot P0A7V3 106-206

8. Domain d2qoyc2: 2qoy C:106-206 [151092]
   Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1
   protein/RNA complex; complexed with mg, nmy, scm
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoyc2

PDB Entry: 2qoy, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qoyc2:

Sequence; same for both SEQRES and ATOM records:

>d2qoyc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

Timeline for d2qoyc2:

• d2qoyc2 first appeared in SCOP 1.75
  
• d2qoyc2 appears in SCOPe 2.05
  
• d2qoyc2 appears in SCOPe 2.07
  
• d2qoyc2 appears in the current release, SCOPe 2.08