Lineage for d2qoyd1 (2qoy D:1-205)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199510Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 2199511Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 2199512Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 2199513Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 2199517Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
    Uniprot P0A7V8 1-205
  8. 2199522Domain d2qoyd1: 2qoy D:1-205 [151093]
    Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1
    protein/RNA complex; complexed with mg, nmy, scm
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoyd1

PDB Entry: 2qoy (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOPe Domain Sequences for d2qoyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qoyd1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

SCOPe Domain Coordinates for d2qoyd1:

Click to download the PDB-style file with coordinates for d2qoyd1.
(The format of our PDB-style files is described here.)

Timeline for d2qoyd1: