![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [159491] (26 PDB entries) Uniprot P0A7V0 8-225 |
![]() | Domain d2qowb1: 2qow B:8-225 [151037] Other proteins in same PDB: d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1 automatically matched to 2AVY B:8-225 complexed with mg, scm |
PDB Entry: 2qow (more details), 3.93 Å
SCOP Domain Sequences for d2qowb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qowb1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]} mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd tnsdpdgvdfvipgnddairavtlylgavaatvregrs
Timeline for d2qowb1: