Lineage for d2qowd1 (2qow D:1-205)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864567Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 864568Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 864569Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 864570Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 864574Species Escherichia coli [TaxId:562] [160439] (26 PDB entries)
    Uniprot P0A7V8 1-205
  8. 864596Domain d2qowd1: 2qow D:1-205 [151040]
    Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qowm1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1
    automatically matched to 2AVY D:1-205
    complexed with mg, scm

Details for d2qowd1

PDB Entry: 2qow (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (D:) 30S ribosomal protein S4

SCOP Domain Sequences for d2qowd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qowd1 d.66.1.2 (D:1-205) Ribosomal protein S4 {Escherichia coli [TaxId: 562]}
arylgpklklsrregtdlflksgvraidtkckieqapgqhgarkprlsdygvqlrekqkv
rriygvlerqfrnyykeaarlkgntgenllallegrldnvvyrmgfgatraearqlvshk
aimvngrvvniasyqvspndvvsirekakkqsrvkaalelaeqrekptwlevdagkmegt
fkrkpersdlsadinehlivelysk

SCOP Domain Coordinates for d2qowd1:

Click to download the PDB-style file with coordinates for d2qowd1.
(The format of our PDB-style files is described here.)

Timeline for d2qowd1: