Lineage for d2qowm1 (2qow M:1-113)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779266Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  6. 779267Protein Ribosomal protein S13 [46948] (2 species)
  7. 779268Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 779290Domain d2qowm1: 2qow M:1-113 [151050]
    Other proteins in same PDB: d2qowb1, d2qowc1, d2qowc2, d2qowd1, d2qowe1, d2qowe2, d2qowf1, d2qowg1, d2qowh1, d2qowi1, d2qowj1, d2qowk1, d2qowl1, d2qown1, d2qowp1, d2qowq1, d2qowr1, d2qows1, d2qowt1, d2qowu1
    automatically matched to 2AVY M:1-114
    complexed with mg, scm

Details for d2qowm1

PDB Entry: 2qow (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOP Domain Sequences for d2qowm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qowm1 a.156.1.1 (M:1-113) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprk

SCOP Domain Coordinates for d2qowm1:

Click to download the PDB-style file with coordinates for d2qowm1.
(The format of our PDB-style files is described here.)

Timeline for d2qowm1: