Lineage for d2qour1 (2qou R:19-73)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763283Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 763284Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 763285Protein Ribosomal protein S18 [46913] (2 species)
  7. 763286Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 763305Domain d2qour1: 2qou R:19-73 [151001]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qous1, d2qout1, d2qouu1
    automatically matched to 2AVY R:19-73
    complexed with mg, scm

Details for d2qour1

PDB Entry: 2qou (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOP Domain Sequences for d2qour1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qour1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOP Domain Coordinates for d2qour1:

Click to download the PDB-style file with coordinates for d2qour1.
(The format of our PDB-style files is described here.)

Timeline for d2qour1: