![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
![]() | Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() |
![]() | Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
![]() | Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160263] (24 PDB entries) Uniprot P0A7V3 106-206 |
![]() | Domain d2qouc2: 2qou C:106-206 [150986] Other proteins in same PDB: d2qoub1, d2qouc1, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1 automatically matched to 2AVY C:106-206 complexed with mg, scm |
PDB Entry: 2qou (more details), 3.93 Å
SCOP Domain Sequences for d2qouc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qouc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]} rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte wyregrvplhtlradidyntseahttygvigvkvwifkgei
Timeline for d2qouc2: