![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234 |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [160143] (26 PDB entries) Uniprot P0A7T3 1-82 |
![]() | Domain d2qoup1: 2qou P:1-82 [150999] Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1 automatically matched to 2AVY P:1-82 complexed with mg, scm |
PDB Entry: 2qou (more details), 3.93 Å
SCOP Domain Sequences for d2qoup1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoup1 d.27.1.1 (P:1-82) Ribosomal protein S16 {Escherichia coli [TaxId: 562]} mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw vgqgatisdrvaalikevnkaa
Timeline for d2qoup1: