![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Trypanosome (Leishmania mexicana) [TaxId:5665] [255557] (3 PDB entries) |
![]() | Domain d2qdgc_: 2qdg C: [150664] automated match to d2alda_ complexed with 2fp, po4 |
PDB Entry: 2qdg (more details), 2.2 Å
SCOPe Domain Sequences for d2qdgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qdgc_ c.1.10.0 (C:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]} msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsddd
Timeline for d2qdgc_: