Lineage for d2alda_ (2ald A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2443025Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2443269Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 2443313Species Human (Homo sapiens), muscle isozyme [TaxId:9606] [51577] (4 PDB entries)
  8. 2443314Domain d2alda_: 2ald A: [29099]

Details for d2alda_

PDB Entry: 2ald (more details), 2.1 Å

PDB Description: human muscle aldolase
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d2alda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2alda_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), muscle isozyme [TaxId: 9606]}
pyqypaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkfsheeiamatvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfvsn
hay

SCOPe Domain Coordinates for d2alda_:

Click to download the PDB-style file with coordinates for d2alda_.
(The format of our PDB-style files is described here.)

Timeline for d2alda_: