Class j: Peptides [58231] (151 folds) |
Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) |
Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
Protein Ribosomal protein S21, RpsU [161310] (1 species) |
Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
Domain d2qbju1: 2qbj U:3-53 [150615] Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjf1, d2qbjg1, d2qbjh1, d2qbji1, d2qbjj1, d2qbjk1, d2qbjl1, d2qbjm1, d2qbjn1, d2qbjp1, d2qbjq1, d2qbjr1, d2qbjs1, d2qbjt1 protein/RNA complex; complexed with lll, mg protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbj (more details), 4 Å
SCOPe Domain Sequences for d2qbju1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbju1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2qbju1: