![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() automatically mapped to Pfam PF00203 |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
![]() | Domain d2qbjs1: 2qbj S:2-80 [150613] Other proteins in same PDB: d2qbjb1, d2qbjc1, d2qbjc2, d2qbjd1, d2qbje1, d2qbje2, d2qbjf1, d2qbjg1, d2qbjh1, d2qbji1, d2qbjj1, d2qbjk1, d2qbjl1, d2qbjm1, d2qbjn1, d2qbjp1, d2qbjq1, d2qbjr1, d2qbjt1, d2qbju1 protein/RNA complex; complexed with lll, mg protein/RNA complex; complexed with lll, mg |
PDB Entry: 2qbj (more details), 4 Å
SCOPe Domain Sequences for d2qbjs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qbjs1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv tdemvghklgefaptrtyr
Timeline for d2qbjs1: