Lineage for d2qbbf1 (2qbb F:1-100)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953643Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2953644Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2953645Protein Ribosomal protein S6 [54997] (4 species)
  7. 2953648Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 2953664Domain d2qbbf1: 2qbb F:1-100 [150386]
    Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbr1, d2qbbs1, d2qbbt1, d2qbbu1
    protein/RNA complex; complexed with lll, mg
    protein/RNA complex; complexed with lll, mg

Details for d2qbbf1

PDB Entry: 2qbb (more details), 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2qbbf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qbbf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2qbbf1:

Click to download the PDB-style file with coordinates for d2qbbf1.
(The format of our PDB-style files is described here.)

Timeline for d2qbbf1: