SCOPe 2.08: Domain d2qbbr1: 2qbb R:19-73

Lineage for d2qbbr1 (2qbb R:19-73)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d2qbbr1: 2qbb R:19-73 [150397]
   Other proteins in same PDB: d2qbbb1, d2qbbc1, d2qbbc2, d2qbbd1, d2qbbe1, d2qbbe2, d2qbbf1, d2qbbg1, d2qbbh1, d2qbbi1, d2qbbj1, d2qbbk1, d2qbbl1, d2qbbm1, d2qbbn1, d2qbbp1, d2qbbq1, d2qbbs1, d2qbbt1, d2qbbu1
   protein/RNA complex; complexed with lll, mg
   protein/RNA complex; complexed with lll, mg

Details for d2qbbr1

PDB Entry: 2qbb, 3.54 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with gentamicin. This file contains the 30S subunit of the second 70S ribosome, with gentamicin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2qbbr1:

Sequence; same for both SEQRES and ATOM records:

>d2qbbr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d2qbbr1:

• d2qbbr1 first appeared in SCOP 1.75
  
• d2qbbr1 appears in SCOPe 2.07