Lineage for d2qanh1 (2qan H:2-128)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3042559Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 3042560Domain d2qanh1: 2qan H:2-128 [150275]
    Other proteins in same PDB: d2qanb1, d2qanc1, d2qanc2, d2qand1, d2qane1, d2qane2, d2qanf1, d2qang1, d2qani1, d2qanj1, d2qank1, d2qanl1, d2qanm1, d2qann1, d2qanp1, d2qanq1, d2qanr1, d2qans1, d2qant1, d2qanu1
    protein/RNA complex; complexed with mg, nmy
    protein/RNA complex; complexed with mg, nmy

Details for d2qanh1

PDB Entry: 2qan (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2qanh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qanh1 i.1.1.1 (H:2-128) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpelelt
lkyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglg
geiicyv

SCOPe Domain Coordinates for d2qanh1:

Click to download the PDB-style file with coordinates for d2qanh1.
(The format of our PDB-style files is described here.)

Timeline for d2qanh1: