Lineage for d2qang1 (2qan G:2-151)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718736Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 2718737Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 2718738Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 2718739Protein Ribosomal protein S7 [47975] (4 species)
  7. 2718742Species Escherichia coli [TaxId:562] [158599] (24 PDB entries)
    Uniprot P02359 2-151
  8. 2718743Domain d2qang1: 2qan G:2-151 [150274]
    Other proteins in same PDB: d2qanb1, d2qanc1, d2qanc2, d2qand1, d2qane1, d2qane2, d2qanf1, d2qanh1, d2qani1, d2qanj1, d2qank1, d2qanl1, d2qanm1, d2qann1, d2qanp1, d2qanq1, d2qanr1, d2qans1, d2qant1, d2qanu1
    protein/RNA complex; complexed with mg, nmy
    protein/RNA complex; complexed with mg, nmy

Details for d2qang1

PDB Entry: 2qan (more details), 3.21 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with neomycin. This file contains the 30S subunit of the second 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes and is described in remark 400.
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2qang1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qang1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]}
rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
elsdaaenkgtavkkredvhrmaeankafa

SCOPe Domain Coordinates for d2qang1:

Click to download the PDB-style file with coordinates for d2qang1.
(The format of our PDB-style files is described here.)

Timeline for d2qang1: