Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) has a circularly permuted topology |
Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins) automatically mapped to Pfam PF01068 |
Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species) |
Species Chlorella virus PBCV-1 [TaxId:10506] [56095] (4 PDB entries) |
Domain d2q2ta2: 2q2t A:2-189 [150015] Other proteins in same PDB: d2q2ta1 automatically matched to d1p8la2 protein/DNA complex; complexed with amp |
PDB Entry: 2q2t (more details), 2.3 Å
SCOPe Domain Sequences for d2q2ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q2ta2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus PBCV-1 [TaxId: 10506]} aitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltellp egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke gillkmkq
Timeline for d2q2ta2: